Cat: PA1000-3975

Recombinant Human SLAMF2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLAMF2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLAMF2;BCM1;CD48 antigen

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09326

  • Expression Region

    27-220aa

  • AA Sequence

    QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKY FESKFKGRVR LDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIK LQVLDPVPKPVIKIEKIEDMDD NCYLKLSCVIPGESVNYTWYGDKRPF PKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKN GTVCLSPPCTLARS

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLAMF2, a member of the SLAM (Signaling Lymphocytic Activation Molecule) family, is an immunoglobulin-like receptor primarily expressed on immune cells, including T cells and B cells. This protein plays a critical role in modulating immune responses, influencing both activation and inhibition of lymphocyte functions. Research has shown that SLAMF2 is involved in various pathological conditions, including autoimmune diseases and viral infections, making it a target of interest for therapeutic interventions. As a receptor that interacts with different ligands, the functional study of SLAMF2 and its signaling pathways is essential for understanding its role in immune regulation. The development of recombinant SLAMF2 proteins facilitates the exploration of its structural and functional properties, allowing researchers to investigate the mechanisms by which it influences immune cell behavior. Furthermore, recombinant SLAMF2 can be used in laboratory settings to generate antibodies or as a part of vaccine development strategies, highlighting its potential for clinical applications. Investigating SLAMF2's role in immune responses not only enhances our understanding of its biology but also contributes to the development of targeted therapies for immune-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US