Analytical Data
-
Gene name
Srpx2
- Application
-
Alternative Names
Srpx2；SRPUL；Sushi repeat-containing Protein SRPX2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60687
-
Expression Region
24-465aa
-
AA Sequence
TWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
-
Molecular Weight
57.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Srpx2 (Sushi-repeat-containing protein 2) is a member of the sushi-repeat-containing proteins, which are characterized by their unique structural motifs and are implicated in various biological processes. Research has indicated that Srpx2 plays a crucial role in neurological development and function, particularly in the formation of synapses and the regulation of neural signaling. Its expression patterns suggest a significant involvement in the central nervous system, where it is predominantly found in neuronal tissues. Abnormalities in Srpx2 expression have been linked to several neurological disorders, including schizophrenia and autism spectrum disorders. The study of Srpx2 recombinant proteins has gained traction as a means to better understand its functional properties and molecular interactions. By producing Srpx2 in a recombinant form, researchers aim to investigate its role in synaptic plasticity and neurodevelopment, as well as its potential as a biomarker for cognitive disorders. Furthermore, recombinant Srpx2 can serve as a valuable tool for elucidating the mechanisms underlying its involvement in neural circuitry and may pave the way for therapeutic strategies targeting Srpx2-related pathways. As the understanding of its function deepens, Srpx2 continues to be a focal point of inquiry in neurobiology, combining insights from molecular biology, genetics, and pharmacology to unravel the complexities of brain function and its pathologies.
