Analytical Data
-
Gene name
SMARCC1
- Application
-
Alternative Names
SMARCC1；BAF155；SWI/SNF complex subunit SMARCC1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92922
-
Expression Region
451-671aa
-
AA Sequence
IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL
-
Molecular Weight
41.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMARCC1, a key component of the SWI/SNF chromatin remodeling complex, plays a pivotal role in regulating gene expression and maintaining chromatin structure. Dysregulation of SMARCC1 has been implicated in various cancers and developmental disorders, making it a significant target for therapeutic intervention. Research has shown that SMARCC1 interacts with numerous transcription factors and co-regulators to modulate the accessibility of chromatin, thereby influencing cellular processes such as differentiation, proliferation, and response to environmental cues. Additionally, studies have highlighted its involvement in DNA repair mechanisms, suggesting that alterations in its function may contribute to genomic instability. As researchers continue to explore the functional dynamics of SMARCC1, including its post-translational modifications and interactions with other molecular pathways, it stands out as a critical focus for understanding the intricate network of gene regulation and its implications for health and disease. The development of recombinant SMARCC1 protein enables detailed studies of its structure-function relationships, offering insights into its mechanistic roles and potential as a biomarker or therapeutic target in oncology and other fields.
