Cat: PAX2000-10435

Recombinant Human POLE Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    POLE

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DNA polymerase epsilon catalytic subunit A. EC:2.7.7.7. 3'-5' exodeoxyribonuclease. EC:3.1.11.-. DNA polymerase II subunit A

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q07864

  • Expression Region

    1-370 aa

  • AA Sequence

    MDPSNYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEEAEESNVEDLLENNWNILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLRRSAPGSTPVRRRGASQLSQEAEGAVGALPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNPALEFIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRSCNFCRDLDLCKDSSFSEDGAVLPQWLCSNCQAPYDSSAIEMTLVEVLQKKLVAFTLQDLVCLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGIFRNIAQHYGMSYLLETLEWLLQKNPQLGH

  • Molecular Weight

    66.44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

POLE (DNA polymerase epsilon) is a crucial enzyme involved in DNA replication and repair, playing a significant role in maintaining the integrity of the genome. Research on POLE has gained momentum due to its association with various neoplastic conditions, particularly certain types of cancers. Mutations in the POLE gene have been identified as a common occurrence in diverse tumors, including endometrial and colorectal cancers. These mutations often lead to an elevated error rate during DNA replication, resulting in hypermutation phenotypes, which can influence tumorigenesis and affect patient prognosis. Understanding the functional implications of POLE mutations is essential not only for elucidating the mechanisms underlying cancer development but also for improving therapeutic strategies. The identification of POLE as a contributor to the hypermutated phenotype has opened new avenues for immunotherapy and targeted treatment approaches, particularly in cancers characterized by high mutation burdens. Researchers are investigating the role of POLE in DNA damage response and its potential interactions with other cellular pathways, aiming to uncover the broader implications of POLE dysfunction in human health. Furthermore, the development of advanced genomic techniques has enabled more comprehensive characterization of POLE-related mutations, facilitating the exploration of their clinical relevance and potential as biomarkers for cancer diagnosis and prognosis. Thus, ongoing studies on POLE and its mutational landscape are imperative for advancing our understanding of cancer biology and enhancing precision medicine strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US