Cat: PA2000-1940

Recombinant Human Cps1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Cps1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cps1;CYP21;CYP21B;Steroid 21-hydroxylase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P31327

  • Expression Region

    1400-1500aa

  • AA Sequence

    ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDN YVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKA A

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Cps1 is a crucial protein involved in the biosynthesis of polysaccharides and has garnered significant attention in biochemical and genetic research due to its role in bacterial virulence and pathogenesis. It is primarily found in certain pathogenic bacteria, where it contributes to the formation of capsules that protect the bacteria from host immune responses. The study of Cps1 recombinant protein is essential, as it provides insights into the mechanisms of bacterial survival and infection. Moreover, understanding its structure and function could have implications for vaccine development and therapeutic strategies against bacterial infections. Recent advances in recombinant DNA technology have enabled the expression and purification of Cps1, allowing for in-depth characterization of its biochemical properties and interaction with other cellular components. This research not only enhances our knowledge of microbial pathogenesis but also opens up potential applications in biomedicine and biotechnology. As researchers continue to explore the functional attributes of Cps1 and its derivatives, the findings could lead to innovative approaches for combating bacterial diseases, making it a focal point in ongoing scientific investigations.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US