Analytical Data
-
Gene name
EPPK1
- Application
-
Alternative Names
EPPK1；EPIPL；Epiplakin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58107
-
Expression Region
1-225aa
-
AA Sequence
MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATTGYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLTYHQLLERCVRAPGSG
-
Molecular Weight
27.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EPPK1, or Epidermal Pigmentary Protein Kinase 1, has emerged as a significant focus of research due to its involvement in various cellular processes related to skin physiology and pathology. Originally identified for its role in the pigmentation pathways, EPPK1 is a serine/threonine kinase that regulates cellular signaling mechanisms critical for melanocyte function and the synthesis of melanin, the pigment responsible for skin color. Its expression has been linked to skin development, differentiation, and response to environmental factors, including UV radiation. Moreover, aberrant EPPK1 activity has been implicated in skin disorders, such as vitiligo and melanoma, highlighting the necessity of understanding its molecular mechanisms. Recombinant EPPK1 protein production allows for detailed biochemical studies, enabling scientists to explore its functional interactions within the signaling networks of skin cells. This research promises to elucidate the role of EPPK1 in normal and pathological conditions, potentially leading to novel therapeutic strategies for pigmentation disorders and skin cancers. By harnessing recombinant technology, researchers aim to produce EPPK1 in sufficient quantities for structural and functional analyses, thereby advancing our understanding of its contributions to dermatological health and disease.
