Analytical Data
-
Gene name
C16orf34
- Application
-
Alternative Names
C16orf34; CRAMP1L; CRML_HUMAN; Hematological and neurological expressed 1-like Protein; HN1L; KIAA1426; Protein cramped-like; TCE4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96RY5
-
Expression Region
1-190aa
-
AA Sequence
MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY
-
Molecular Weight
46.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C16orf34, a gene located on human chromosome 16, has garnered increasing attention in recent years due to its potential association with various biological processes and diseases. Initially classified as a protein of unknown function, advances in genomics and proteomics have allowed researchers to investigate its role more deeply. Studies suggest that C16orf34 may participate in cellular mechanisms related to signal transduction and metabolic regulation, thereby influencing cancer progression, immune responses, and neurodegenerative disorders. Furthermore, its expression levels appear to vary significantly across different tissues and developmental stages, hinting at a versatile role in human physiology. The recombinant expression of C16orf34 has enabled scientists to produce the protein in vitro, facilitating structural and functional analyses. Understanding the properties of this protein could lead to the identification of novel therapeutic targets and biomarkers, enhancing our knowledge of its involvement in health and disease. As such, ongoing research is pivotal for elucidating the biological significance of C16orf34 and its potential utility in clinical applications.
