Analytical Data
-
Gene name
RPS27
- Application
-
Alternative Names
RPS27；MPS1；Small ribosomal subunit Protein eS27
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42677
-
Expression Region
1-84aa
-
AA Sequence
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
-
Molecular Weight
36.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPS27, or Ribosomal Protein S27, is a component of the ribosomal machinery, playing a crucial role in protein synthesis within eukaryotic cells. Its importance has gained traction in recent years due to its involvement in various cellular processes, including ribosome biogenesis, cell proliferation, and the regulation of apoptotic pathways. Studies have indicated that RPS27 may have implications in cancer biology, as its expression levels are often altered in malignant tissues compared to normal cells. The investigation of recombinant RPS27 protein has become a focal point in understanding its functional roles and regulatory mechanisms. By producing RPS27 in a recombinant form, researchers aim to characterize its biochemical properties, delineate its interaction with other ribosomal proteins, and elucidate its contribution to translational control. Furthermore, recombinant RPS27 serves as a valuable tool for studying the structural basis of ribosome assembly and function, potentially leading to the identification of novel therapeutic targets for diseases linked to ribosomal dysfunction. As the complexities of RPS27's involvement in various biological mechanisms unfold, its study not only enhances our knowledge of ribosomal dynamics but also highlights the potential of targeting ribosomal components as a strategy in cancer treatment and other diseases.
