Analytical Data
-
Gene name
RAPGEF2
- Application
-
Alternative Names
CNrasGEF; Cyclic nucleotide ras GEF; KIAA0313; Neural RAP guanine nucleotide exchange protein; nRap GEP; NRAPGEP; PDZ domain containing guanine nucleotide exchange factor 1; PDZ domain-containing guanine nucleotide exchange factor 1; PDZ GEF1; PDZ-GEF1; PDZGEF1; RA GEF; RA-GEF-1; Rap guanine nucleotide exchange factor 2; Rapgef2; Ras/Rap1-associating GEF-1; RPGF2_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y4G8
-
Expression Region
1398-1487 aa
-
AA Sequence
PITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV
-
Molecular Weight
35.64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAPGEF2, a member of the Ras-activating protein family, plays a pivotal role in cellular signaling pathways, particularly in the modulation of Ras, a key regulator of cell proliferation, differentiation, and survival. Research has shown that RAPGEF2 interacts with small GTPases like Rap1, influencing various biological processes including cell adhesion, migration, and synaptic signaling. Its dysregulation has been implicated in several diseases, including cancer and neurodevelopmental disorders. Understanding the structure and function of RAPGEF2 at a molecular level is essential for deciphering its role in these pathways. Recombinant protein studies of RAPGEF2 aid in elucidating its biochemical properties, interaction mechanisms, and potential as a therapeutic target. By producing and analyzing recombinant RAPGEF2, researchers aim to uncover insights into its activity and regulatory roles within the cell, contributing to the development of novel strategies for disease intervention and treatment.
