Analytical Data
-
Gene name
RBBP6
- Application
-
Alternative Names
DKFZp686P0638; DKFZp761B2423; E3 ubiquitin-protein ligase RBBP6; MY038; P2P R; P2PR; p53 associated cellular protein of testis; p53-associated cellular protein of testis; p53-associated cellular protein. testis-derived; PACT; Proliferation potential related protein; Proliferation potential-related protein; Protein P2P R; Protein P2P-R; Protein P2PR; Protein RBQ 1; Protein RBQ1; RB binding protein 6. ubiquitin ligase; RB binding Q protein 1; RBBP 6; Rbbp6; RBBP6_HUMAN; RBQ 1; RBQ-1; RBQ1; Retinoblastoma binding protein 6 isoform 3; Retinoblastoma binding Q protein 1; Retinoblastoma-binding protein 6; Retinoblastoma-binding Q protein 1; SNAMA; SNAMA. Drosophila. homolog of
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z6E9
-
Expression Region
1-118 aa
-
AA Sequence
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL
-
Molecular Weight
39.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RBBP6 (Retinoblastoma-Binding Protein 6) is a multifunctional protein that plays significant roles in various cellular processes, including cell cycle regulation, apoptosis, and gene expression. Its involvement in tumor biology has garnered considerable attention, as RBBP6 is known to interact with several key tumor suppressors, such as p53 and the retinoblastoma protein (Rb), thereby influencing pathways related to cancer development and progression. Recent studies have highlighted the potential of RBBP6 as a therapeutic target due to its overexpression in various malignancies, suggesting a role in promoting tumor growth and resistance to therapy. The recombinant RBBP6 protein has been produced to facilitate a deeper understanding of its functional mechanisms and interactions at the molecular level. Characterizing the structure and function of RBBP6 can yield insights into its role in oncogenic processes and help identify potential interventions in cancer treatment. Overall, the research on RBBP6 recombinant protein is crucial for elucidating its contributions to tumorigenesis and for exploring its potential as a biomarker or therapeutic target in oncology.
