Analytical Data
-
Gene name
CACFD1
- Application
-
Alternative Names
CACFD1; C9orf7; PSEC0107; PSEC0248; UNQ3071/PRO9903; Calcium channel flower homolog; Calcium channel flower domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UGQ2
-
Expression Region
1-172aa
-
AA Sequence
MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL
-
Molecular Weight
44.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CACFD1, a protein encoded by the CACFD1 gene, has garnered attention in recent years due to its potential role in cellular processes and disease mechanisms. Research indicates that CACFD1 may be involved in regulating cell adhesion and proliferation, making it a candidate for further investigation in cancer biology. The interest in CACFD1 has grown as studies suggest it might play a pivotal role in modulating immune responses and inflammation, which are critical in various pathological conditions, including autoimmune diseases and cancer metastasis. Recombinant forms of CACFD1 are being developed for experimental studies to elucidate its structure-function relationship and to explore its potential as a biomarker or therapeutic target. Understanding the biochemical pathways involving CACFD1 could provide insights into novel treatment strategies. Despite the promising leads, comprehensive characterizations of CACFD1's functional domains and interactions remain limited. Therefore, researching the recombinant protein is essential for dissecting its biological roles and clinical implications. This research aims to bridge the gap in knowledge surrounding CACFD1 and to propel its potential applications in molecular diagnostics and therapeutics.
