Analytical Data
-
Gene name
CACNB2
- Application
-
Alternative Names
Voltage-dependent L-type calcium channel subunit beta-2. CAB2. Calcium channel voltage-dependent subunit beta 2. Lambert-Eaton myasthenic syndrome antigen B. MYSB
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q08289
-
Expression Region
213-301aa
-
AA Sequence
PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
-
Molecular Weight
35.53 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CACNB2, a gene encoding the beta-2 subunit of voltage-gated calcium channels, plays a crucial role in various physiological processes, including muscle contraction, neurotransmitter release, and cardiac function. Abnormalities in CACNB2 expression and function have been linked to various diseases, including epilepsy, cardiac arrhythmias, and schizophrenia. The study of CACNB2 recombinant proteins has gained attention as it allows researchers to investigate the structure-function relationships of calcium channels and their interactions with other cellular components. By producing and characterizing CACNB2 recombinant proteins, scientists can elucidate the mechanisms by which calcium channels regulate cellular signaling pathways and contribute to disease pathology. Additionally, these studies may pave the way for the development of targeted therapies aimed at modulating calcium channel activity in various disorders. Understanding the functional properties of CACNB2 may also enhance our knowledge of calcium dynamics in health and disease, ultimately leading to novel therapeutic strategies. Therefore, the recombinant expression and analysis of CACNB2 are critical for advancing our understanding of calcium channel biology and its implications in cellular function and disease.
