Analytical Data
-
Gene name
REEP5
- Application
-
Alternative Names
Receptor expression-enhancing protein 5. Polyposis locus protein 1. Protein TB2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00765
-
Expression Region
1-185 aa
-
AA Sequence
MRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
-
Molecular Weight
47.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
REEP5, a member of the REEP (Receptor Expression Enhancer Protein) family, has garnered significant interest in recent years due to its potential roles in various cellular processes, including protein trafficking and membrane dynamics. Initially identified as a factor influencing G protein-coupled receptor (GPCR) expression, REEP5 has been implicated in the modulation of receptor signaling pathways, impacting physiological responses such as neurotransmission and hormone signaling. Its unique ability to interact with cellular membranes suggests that REEP5 may play a crucial role in shaping organelle morphology and function, particularly in the endoplasmic reticulum (ER). Dysregulation of REEP5 has been linked to various diseases, including certain neurodegenerative disorders and cancers, highlighting its significance as a potential biomarker or therapeutic target. Furthermore, studies have demonstrated that REEP5 can affect the stability and localization of its interactors, providing insights into its mechanistic functions in cellular homeostasis. Given its multifaceted roles, ongoing research into the structure and function of REEP5, particularly its recombinant forms, is essential for elucidating its contributions to cellular physiology and pathophysiology, paving the way for novel interventions in relevant diseases.
