Cat: PA1000-5741

Recombinant Human NPC2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NPC2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NPC2;HE1;NPC intracellular cholesterol transporter 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P61916

  • Expression Region

    20-151aa

  • AA Sequence

    EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKS SKAVVHGILM GVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQ LQDDKNQSLF CWEIPVQIVSHL

  • Molecular Weight

    17 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NPC2 (Niemann-Pick C2 protein) is a crucial intracellular lipid transport protein involved in the metabolism of cholesterol and other lipids, playing a significant role in lipid homeostasis and cellular signaling. Mutations in the NPC2 gene are associated with Niemann-Pick disease type C, a progressive neurodegenerative disorder characterized by lysosomal dysfunction and impaired cholesterol trafficking. Research on NPC2 recombinant protein has gained momentum as scientists seek to understand its structure-function relationship, which is essential for deciphering its role in lipid transfer and its implications in disease mechanisms. The recombinant form of NPC2 enables researchers to conduct detailed studies on its biochemical properties, interactions with other cellular components, and therapeutic potential. By producing NPC2 in heterologous systems, researchers can elucidate its function in lipid metabolism and explore strategies for potential therapeutic interventions, making NPC2 recombinant protein a valuable tool in both fundamental research and clinical applications aimed at treating lipid-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US