Analytical Data
-
Gene name
NPC2
- Application
-
Alternative Names
NPC2;HE1;NPC intracellular cholesterol transporter 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61916
-
Expression Region
20-151aa
-
AA Sequence
EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKS SKAVVHGILM GVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQ LQDDKNQSLF CWEIPVQIVSHL
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NPC2 (Niemann-Pick C2 protein) is a crucial intracellular lipid transport protein involved in the metabolism of cholesterol and other lipids, playing a significant role in lipid homeostasis and cellular signaling. Mutations in the NPC2 gene are associated with Niemann-Pick disease type C, a progressive neurodegenerative disorder characterized by lysosomal dysfunction and impaired cholesterol trafficking. Research on NPC2 recombinant protein has gained momentum as scientists seek to understand its structure-function relationship, which is essential for deciphering its role in lipid transfer and its implications in disease mechanisms. The recombinant form of NPC2 enables researchers to conduct detailed studies on its biochemical properties, interactions with other cellular components, and therapeutic potential. By producing NPC2 in heterologous systems, researchers can elucidate its function in lipid metabolism and explore strategies for potential therapeutic interventions, making NPC2 recombinant protein a valuable tool in both fundamental research and clinical applications aimed at treating lipid-related disorders.











