Analytical Data
-
Gene name
CCNB3
- Application
-
Alternative Names
CCNB3; CYCB3G2/mitotic-specific cyclin-B3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WWL7
-
Expression Region
1296-1395aa
-
AA Sequence
VQEKASKLAAASLLLALYMKKLGYWVPFLEHYSGYSISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLEEILNCDCEAQGLVL
-
Molecular Weight
36.74 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCNB3, or Cyclin B3, is a member of the cyclin family involved in cell cycle regulation, particularly in the transition from the G2 phase to mitosis. It has garnered significant attention in cancer research due to its potential role in tumorigenesis and cell proliferation. Studies have shown that CCNB3 is overexpressed in various tumors, suggesting it may serve as a biomarker for cancer diagnosis or prognosis, as well as a potential therapeutic target. The protein's distinct expression patterns during meiosis and mitosis further imply its involvement in germ cell development and reproductive biology. Additionally, research has indicated that CCNB3 interacts with various cyclin-dependent kinases (CDKs), influencing the phosphorylation of critical substrates necessary for cell division. Given its pivotal role in cell cycle control and its association with cancer, the recombinant expression and characterization of CCNB3 becomes crucial. Investigating its structure and function through recombinant protein technology enables a better understanding of its mechanisms and interactions, paving the way for novel cancer therapies and interventions targeting cyclin-dependent pathways. As such, CCNB3 is a promising candidate for further exploration in both fundamental research and clinical applications, highlighting the need for continued studies into its biochemical properties and potential as a drug target.
