Analytical Data
-
Gene name
cry1Ab
- Application
-
Alternative Names
cry1Ab；Cryptochrome-1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A370
-
Expression Region
1022-1155aa
-
AA Sequence
HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
-
Molecular Weight
17.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cry1Ab recombinant protein is derived from the bacterium *Bacillus thuringiensis* (Bt), known for its insecticidal properties. This protein has garnered significant interest in agricultural biotechnology due to its effectiveness against various insect pests, particularly from the orders Lepidoptera, which includes many harmful agricultural pests. The research into Cry1Ab began in the late 20th century when scientists discovered that Bt produces proteins that are toxic to specific insects upon ingestion. These proteins act by binding to midgut receptors in the insects, leading to cell lysis and ultimately death. The ability to express Cry1Ab in genetically modified crops, such as Bt cotton and Bt corn, provides a sustainable solution for pest control, reducing the reliance on chemical pesticides and promoting environmentally friendly farming practices. Studies have focused on optimizing the expression levels, stability, and efficacy of the Cry1Ab protein to enhance its pest resistance properties. Furthermore, understanding the molecular mechanisms of its action and potential non-target effects is crucial for evaluating the safety and ecological impact of Bt crops. As agricultural demands grow alongside concerns about insect resistance and environmental sustainability, the research on Cry1Ab recombinant protein continues to play a pivotal role in developing innovative pest management strategies.
