Analytical Data
-
Gene name
mxiH
- Application
-
Alternative Names
mxiH；mxiH；Type 3 secretion system needle filament Protein
-
Species
Shigella flexneri
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A223
-
Expression Region
1-83aa
-
AA Sequence
MSVTVPNDDWTLSSLSETFDDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAIIQNFR
-
Molecular Weight
16.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of mxiH recombinant protein is situated within the broader context of antibiotic resistance and the urgent need for novel therapeutic approaches. mxiH is a gene associated with the type III secretion system in certain pathogenic bacteria, such as *Salmonella* and *Shigella*, which plays a crucial role in their virulence by facilitating the delivery of effector proteins into host cells. The understanding of mxiH and its encoded protein is essential for unraveling the mechanisms of bacterial pathogenicity and host interactions. Recent advancements in recombinant protein technology have enabled researchers to produce mxiH protein in a laboratory setting, facilitating detailed studies on its structure, function, and potential as a target for drug development. Moreover, as pathogens evolve increasingly complex mechanisms to evade the immune system, investigating mxiH may provide insights into new therapeutic strategies to counteract infections caused by these resilient bacteria. The research into this protein could lead to the development of vaccines or inhibitors that specifically disrupt the type III secretion system, thereby reducing the pathogenicity of these bacteria and addressing the pressing issue of antibiotic resistance in modern medicine.
