Analytical Data
-
Gene name
CCNJ
- Application
-
Alternative Names
bA690P14.1; Ccnj; CCNJ_HUMAN; Cyclin J; Cyclin-J
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T5M9
-
Expression Region
1-372aa
-
AA Sequence
MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITPCFER
-
Molecular Weight
66.66 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCNJ, also known as cyclin J, is a member of the cyclin family that plays a crucial role in cell cycle regulation. Research on CCNJ has gained significance due to its involvement in various cellular processes, including cell proliferation, differentiation, and apoptosis. Alterations in CCNJ expression and function have been linked to several diseases, particularly cancer, where dysregulation of cell cycle control is a hallmark. Investigating recombinant CCNJ proteins offers insights into its structural and functional properties, enabling a better understanding of its role in normal cellular mechanisms and disease states. Additionally, recombinant protein studies provide a platform for exploring potential therapeutic targets and strategies, as manipulating CCNJ pathways may enhance treatment outcomes in cancer and other proliferative disorders. As such, the study of CCNJ through recombinant technology not only enriches our understanding of cell cycle dynamics but also paves the way for innovative approaches to combat diseases associated with its dysfunction.
