Analytical Data
-
Gene name
MSLN
- Application
-
Alternative Names
MSLN；MPF；Mesothelin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13421
-
Expression Region
37-286aa
-
AA Sequence
LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELA VALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQA CTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALG GLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGP PSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPER
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MSLN (mesothelin) is a membrane-bound glycoprotein that is overexpressed in several malignancies, including mesothelioma, pancreatic cancer, and ovarian cancer, making it a potential target for cancer immunotherapy. The study of MSLN recombinant proteins has gained significant traction due to their ability to elicit immune responses against tumors expressing this antigen. Researchers have focused on generating MSLN recombinant proteins for use as diagnostic markers and therapeutic agents. These proteins can be engineered to improve their immunogenicity and specificity, enabling the development of monoclonal antibodies or immune cell therapies that selectively attack MSLN-expressing cancer cells. Additionally, MSLN may play a role in tumor progression and metastasis, further highlighting its relevance in cancer biology. With the advancement of biotechnological methods, including recombinant DNA technology, scientists are now able to produce MSLN proteins in sufficient quantities and purities, paving the way for preclinical and clinical studies. Investigating MSLN-targeted therapies not only offers a promising avenue for improving cancer treatment outcomes but also provides insights into the mechanisms of tumor immunity and the complex interactions between tumors and the immune system. Continued research into MSLN and its recombinant proteins is essential to unlock their full potential in the fight against cancer and to develop innovative therapeutic strategies.
