Cat: PA2000-6674

Recombinant Human CHD2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CHD2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    2810013C04Rik; 2810040A01Rik; 5630401D06Rik; AI851092; ATP dependent helicase CHD2; ATP-dependent helicase CHD2; BC029703; CHD 2; CHD-2; CHD2; CHD2_HUMAN

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14647

  • Expression Region

    260-456

  • AA Sequence

    MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSETIEKVLDSRLGKKGATG ASTTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTWESEESLQ QQKVKGLKKLENFKKKEDEIKQWLGKVSPEDVEYFNCQQELASELNKQYQ IVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWE DEALIGKKFQNCIDSFHSRNNSKTIPTR

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CHD2 (Chromodomain Helicase DNA Binding Protein 2) is a member of the CHD protein family, which plays a crucial role in chromatin remodeling and regulation of gene expression. It contains chromodomains that are involved in recognizing methylated lysines on histones, linking it to epigenetic regulation. Recent studies have highlighted CHD2's essential functions in maintaining genome stability, controlling DNA repair processes, and influencing cell differentiation and development. Furthermore, mutations in the CHD2 gene have been associated with various neurological disorders, underscoring its significance in human health. The investigation of recombinant CHD2 protein is pivotal for understanding its functional mechanisms, interactions with DNA and other proteins, and the pathways it regulates. By producing and analyzing recombinant CHD2, researchers aim to elucidate its role in chromatin dynamics and its implications in disease, thereby advancing the potential for targeted therapies. This research could also enhance our understanding of fundamental biological processes, such as transcription regulation and cellular response to DNA damage, contributing to the broader field of epigenetics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US