Analytical Data
-
Gene name
CDH15
- Application
-
Alternative Names
CDH15;CDH14;CDH3;Cadherin-15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55291
-
Expression Region
61-246aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFLPYPLVQIKSDKQQLGSVIYS IQGPGVDEEPRGVFSIDKFTGKVFLNAMLDREKTDRFRLRAFALDLGGST LEDPTDLEIVVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDADD PETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQ VADMSGDGLTATASAWAHNSRNLVAAALRVVAVAVVVAAVAN
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDH15, or Cadherin 15, is a member of the cadherin superfamily of proteins, which are crucial for cell adhesion and play significant roles in various biological processes, including embryogenesis, tissue formation, and maintenance of cell layer integrity. The study of CDH15 is particularly important due to its involvement in the development of the nervous system and its potential implications in neurological disorders. Research has shown that CDH15 is expressed in specific regions of the brain, where it contributes to synaptic formation and stability, suggesting its critical role in neural communication. Additionally, mutations or dysregulation of CDH15 have been associated with various pathologies, including autism spectrum disorders and other cognitive dysfunctions, making it a target of interest for therapeutic interventions. To better understand its functions and mechanisms, the production of recombinant CDH15 protein has become a focal point in research. This recombinant protein allows scientists to study its structural properties, binding characteristics, and interactions with other cellular components in vitro. Furthermore, characterizing CDH15 through recombinant techniques may shed light on the pathways it influences and provide insights into its role in health and disease. Overall, the investigation of CDH15 recombinant protein represents a significant step towards elucidating the complexities of cell adhesion processes in the nervous system and developing potential therapeutic strategies for related disorders.











