Cat: PA2000-3147

Recombinant Human NXNL2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NXNL2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NXNL2;C9orf121;Nucleoredoxin-like Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5VZ03

  • Expression Region

    1-135aa

  • AA Sequence

    MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS

  • Molecular Weight

    30.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NXNL2, a member of the NIX family, is a naturally occurring protein predominantly expressed in the retinal neural cells. Research into NXNL2 has garnered attention due to its potential implications in retinal health and disease. The protein is known to play a critical role in the maintenance and function of photoreceptors, which are essential for vision. Mutations or dysregulation of NXNL2 have been linked to various retinal disorders, including retinitis pigmentosa and age-related macular degeneration, conditions that lead to progressive vision loss. Furthermore, NXNL2 is implicated in the protective mechanisms against oxidative stress and inflammation within the retinal environment. Given the increasing prevalence of retinal diseases and their profound impact on quality of life, understanding the function and therapeutic potential of NXNL2 is crucial. Recent advances in molecular biology techniques have enabled the recombinant expression of NXNL2, allowing for detailed biochemical characterization and exploration of its functional properties. This research not only enhances our understanding of NXNL2's role in retinal biology but also opens up avenues for developing novel strategies aimed at the treatment or prevention of retinal diseases associated with this protein.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US