Cat: PA1000-7408

Recombinant Human PTK6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PTK6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PTK6;BRK;Protein-tyrosine kinase 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13882

  • Expression Region

    2-451aa

  • AA Sequence

    VSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLD EAGGAVAQGYVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATGA FLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPEL VNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGY FGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALY AVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMC YLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIPY KWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVD AGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT

  • Molecular Weight

    80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PTK6 (Protein Tyrosine Kinase 6), also known as scabl or BRK (breast tumor kinase), is a non-receptor tyrosine kinase that plays a crucial role in various cellular processes, including cell proliferation, survival, and differentiation. It is predominantly expressed in epithelial tissues and has been implicated in breast cancer and other malignancies, making it a significant focus of cancer research. PTK6 is activated in response to various extracellular signals and is known to modulate signaling pathways, including those involving integrins and receptor tyrosine kinases. Its dysregulation has been linked to tumorigenesis and metastasis, underscoring the importance of elucidating its functional mechanisms. Recombinant PTK6 protein is vital for studying its biochemical properties, interactions with substrates, and regulatory mechanisms. Producing PTK6 in a recombinant form allows for a detailed analysis of its kinase activity and potential therapeutic targets, contributing to our understanding of its role in cancer and offering insights for the development of targeted therapies. The exploration of PTK6 functions through recombinant protein research not only enhances our comprehension of its involvement in cancer biology but also facilitates the identification of novel drug candidates that could inhibit its activity in cancerous cells.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US