Analytical Data
-
Gene name
Bax
- Application
-
Alternative Names
Bax；BCL2L4；Apoptosis regulator BAX
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07812
-
Expression Region
1-192aa
-
AA Sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
-
Molecular Weight
23.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Bax, a pro-apoptotic protein belonging to the Bcl-2 family, plays a crucial role in the intrinsic pathway of programmed cell death. It is known for its ability to permeabilize the mitochondrial membrane, leading to the release of cytochrome c and subsequent activation of caspases, which are essential for executing apoptosis. Research on Bax has gained momentum due to its implications in various diseases, including cancer, where its expression levels often correlate with the cell's response to chemotherapeutic agents. Understanding Bax’s structure and function provides insights into its regulatory mechanisms and potential as a therapeutic target. Recombinant Bax protein studies have facilitated the exploration of its interaction with other mitochondrial proteins and the elucidation of its apoptotic mechanisms at the molecular level. These studies aim to define how Bax and its homologs contribute to the balance of cell survival and death, which is pivotal in therapeutic contexts, especially in cancer treatment strategies aiming to restore apoptotic pathways in resistant cells. Thus, the investigation of recombinant Bax not only enhances comprehension of the apoptotic process but also fosters the development of novel approaches to modulate apoptosis in various diseases, thereby illuminating new potential for targeted cancer therapies.
