Analytical Data
-
Gene name
SLC25A33
- Application
-
Alternative Names
SLC25A33; Solute carrier family 25 member 33; Bone marrow stromal cell mitochondrial carrier protein; BMSC-MCP; HuBMSC-MCP; Protein PNC1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BSK2
-
Expression Region
1-321 aa
-
AA Sequence
MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ
-
Molecular Weight
61.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A33, a member of the solute carrier family 25, plays a crucial role in mitochondrial transport processes, particularly in the transport of nucleotides and small molecules across the mitochondrial membrane. Recent studies have highlighted its involvement in various cellular functions, including energy metabolism, apoptosis, and the regulation of intracellular calcium levels. Aberrant expression or malfunction of SLC25A33 has been linked to several metabolic disorders and mitochondrial diseases, making it a significant target for therapeutic interventions. The recombinant expression of SLC25A33 in model systems allows for detailed investigation of its structural and functional properties, facilitating a better understanding of its role in cellular metabolism. Such research aims to elucidate the mechanisms by which SLC25A33 contributes to mitochondrial function and its implications in human health and disease. Additionally, understanding SLC25A33’s interactions with other mitochondrial proteins and its regulatory pathways could provide insights into potential drug targets for conditions associated with mitochondrial dysfunction. Thus, the recombinant protein of SLC25A33 serves as a valuable tool for advancing knowledge in mitochondrial biology and developing new therapeutic strategies.
