Analytical Data
-
Gene name
SLIC1
- Application
-
Alternative Names
Selectin ligand interactor cytoplasmic 1 ; Selectin ligand-interactor cytoplasmic 1; SLIC1; Snx20; SNX20_HUMAN; sorting nexin 20; Sorting nexin-20
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z614
-
Expression Region
1-102 aa
-
AA Sequence
MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQ
-
Molecular Weight
38.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLIC1, or SLC41A1, is a member of the solute carrier family that plays a crucial role in cellular ion transport and homeostasis, particularly in the regulation of magnesium levels within various cell types. Research on SLIC1 has garnered attention due to its potential implications in several physiological and pathological processes, including its involvement in neuronal function and muscle contractions. Abnormalities in magnesium transport associated with SLIC1 have been linked to various diseases, such as hypertension and neurodegenerative disorders. The study of SLIC1 recombinant proteins is essential for understanding its structural and functional properties, which can provide insights into its mechanism of action and the significance of magnesium in cellular contexts. Furthermore, investigating the interactions of SLIC1 with other cellular components may uncover novel therapeutic targets for conditions related to magnesium imbalance. Given the increasing evidence of SLIC1's role in critical biological pathways, the development of recombinant SLIC1 proteins has become a pivotal focus in molecular biology and therapeutic research, aiming to leverage this knowledge for clinical applications.
