Cat: PA2000-3474

Recombinant E.coli isaB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    isaB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    isaB;Immunodominant staphylococcal antigen B

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9LAB5

  • Expression Region

    37-175aa

  • AA Sequence

    AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

  • Molecular Weight

    20.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of IsaB recombinant protein is rooted in the growing interest in understanding the mechanisms of bacterial pathogenesis and the development of novel therapeutic strategies. IsaB, a protein associated with the pathogenicity of certain bacterial species, plays a crucial role in regulating iron homeostasis and facilitating the uptake of iron, an essential nutrient for bacterial survival and growth. The lack of effective treatments against antibiotic-resistant bacteria has heightened the urgency for new approaches, including the exploration of protein-based therapies. Research on IsaB is particularly significant due to its potential as a target for drug design, as inhibiting its function may disrupt bacterial iron acquisition, thereby attenuating virulence. Advances in recombinant DNA technology have enabled the production of IsaB in heterologous expression systems, allowing for detailed structural and functional studies. Understanding the three-dimensional structure of IsaB through techniques such as X-ray crystallography and cryo-electron microscopy can provide insights into its interaction with host factors and reveal potential binding sites for therapeutic agents. Furthermore, the characterization of IsaB's immunogenic properties may lead to the development of vaccine candidates against pathogenic bacteria. Overall, the exploration of IsaB recombinant protein is a vital endeavor in the field of microbiology, with implications for vaccine development, therapeutic interventions, and the mitigation of infectious diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US