Analytical Data
-
Gene name
FBA1
- Application
-
Alternative Names
FBA1；Fructose-bisphosphate aldolase 1. chloroplastic
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9URB4
-
Expression Region
2-359aa
-
AA Sequence
APPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGIRDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL
-
Molecular Weight
46.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBA1, or fructose-bisphosphate aldolase 1, is an enzyme that plays a critical role in glycolysis and gluconeogenesis, converting fructose-1,6-bisphosphate into dihydroxyacetone phosphate and glyceraldehyde-3-phosphate. Research on FBA1 has garnered significant interest due to its essential function in carbohydrate metabolism and potential implications in metabolic disorders, cancer, and various physiological processes. Recombinant FBA1 protein is often produced for biochemical studies to elucidate its structure-function relationships, enzymatic mechanisms, and interactions with other metabolic pathways. The reconstitution of FBA1 allows scientists to explore its catalytic properties, substrate specificity, and regulation under different conditions. Moreover, the study of FBA1’s role in specific organisms, from yeast to mammals, offers insights into evolutionary aspects of metabolic regulation. Understanding FBA1 at the molecular level can also provide a foundation for developing novel therapeutic strategies targeting metabolic diseases, making it a significant focus in the field of biochemistry and molecular biology. As such, the production and characterization of FBA1 recombinant protein are crucial for advancing our understanding of its biological significance and potential applications in biotechnology and medicine.
