Analytical Data
-
Gene name
Smad7
- Application
-
Alternative Names
Smad7；MADH7；MADH8；Mothers against decapentaplegic homolog 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15105
-
Expression Region
160-260aa
-
AA Sequence
CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPP PYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRS H
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Smad7 is a critical protein involved in the transforming growth factor-beta (TGF-β) signaling pathway, which plays a vital role in regulating various biological processes, including cell proliferation, differentiation, and apoptosis. As an inhibitory Smad, Smad7 functions by antagonizing the actions of receptor-activated Smads, effectively preventing the transcriptional activation of target genes induced by TGF-β signals. Research has shown that aberrant regulation of Smad7 is associated with a range of diseases, including cancer, fibrosis, and autoimmune disorders. Due to its role in moderating TGF-β signaling, Smad7 has garnered interest as a potential therapeutic target. Recombinant Smad7 protein studies aim to elucidate its mechanistic roles and effects on cellular processes. Through the production of recombinant Smad7, researchers can investigate its interactions with other signaling molecules, its impact on gene expression, and its overall contribution to pathophysiological conditions. Furthermore, the development of Smad7-based therapies may offer novel strategies for treating TGF-β-related diseases by restoring its regulatory functions. As the understanding of Smad7 continues to evolve, it stands as a promising focal point for innovative medical interventions and a deeper comprehension of TGF-β signaling mechanisms.
