Analytical Data
-
Gene name
SSX4B
- Application
-
Alternative Names
Cancer/testis antigen 5.4; CT5.4; MGC12411; Protein SSX4; SSX4_HUMAN; SSX4B; Synovial sarcoma X breakpoint 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60224
-
Expression Region
1-188 aa
-
AA Sequence
MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
-
Molecular Weight
48.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SSX4B is a member of the SSX family of proteins, which are known as cancer/testis antigens (CTAs) and are typically expressed in male germ cells and various types of tumors. The study of SSX4B has gained importance due to its potential role in tumor immunology, as it is often presented by MHC class I molecules on the surface of cancer cells, making it a target for immunotherapeutic approaches. Research has revealed that SSX4B is involved in tumorigenesis and can elicit T cell responses, which could be harnessed for developing cancer vaccines or adoptive T cell therapies. Unlike many other proteins, the expression of SSX4B is largely restricted to cancer tissues, which raises the possibility of using it as a biomarker for diagnosis or prognosis in tumor patients. Furthermore, understanding the structure and function of SSX4B at the molecular level could provide insights into its mechanism of action in cancer progression and immune evasion. Recent studies have focused on characterizing SSX4B recombinant protein, which involves expressing it in suitable systems for further analysis, including its interactions with immune cells and its ability to induce anti-tumor responses. Overall, the ongoing research into SSX4B and its implications in cancer therapy represents a promising frontier in the field of oncology and personalized medicine.
