Analytical Data
-
Gene name
ZCWPW1
- Application
-
Alternative Names
ZCWPW1Zinc finger CW-type PWWP domain Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0M4
-
Expression Region
1-477 aa
-
AA Sequence
MGSGLDFAETSCAQPVVSTQSDKEPGITASAADTDNANGEEVPHTQEISVSWEGEAAPEIRTSKLGQPDPAPSKKKSNRLTLSKRKKEAQDEKVEKTQGGHEHRQEDRLKKTVQDHSQIRDQQKGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLESDVAYASYIPGSIIWAKQYGYPWWPGMIESDPDLGEYFLFTSHLDSLPSKYHVTFFGETVSRAWIPVNMLKNFQELSLELSVMKKRRNDCSQKLGVALMMAQEAEQISIQERVNLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTDPILPIRKRVKIQTQKTKPRGPKKKFKAPQSKALAASFSEGKEVRTVPKNLGLSACKGACPSSAKEEPRHREPLTQEAGSVPLEDEASSDLDLEQLMEDVGRELGQSGELQHSNSDGEDFPVALFGK
-
Molecular Weight
79.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ZCWPW1 protein, known for its role in cellular processes such as cell cycle regulation and gene expression modulation, has garnered significant interest in the field of molecular biology and biomedical research. It belongs to the ZCWPW family, which is characterized by the presence of zinc finger and WW domains, suggesting a potential involvement in protein-protein interactions and transcriptional regulation. Studies have indicated that ZCWPW1 may play a crucial role in various physiological and pathological contexts, including cancer progression and immune responses. Its expression patterns and functional implications in disease pathology necessitate further investigation. Researchers are increasingly focused on understanding the molecular mechanisms underlying ZCWPW1's activity, particularly its interactions with other cellular proteins and its contribution to signaling pathways. Additionally, the potential of ZCWPW1 as a target for therapeutic intervention in diseases where its dysregulation is implicated is beginning to be explored. Overall, the investigation of ZCWPW1 not only enriches our understanding of fundamental biological processes but also opens avenues for novel diagnostic and therapeutic strategies in related disorders.











