Analytical Data
-
Gene name
TRH
- Application
-
Alternative Names
TRH；Pro-thyrotropin-releasing hormone
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20396
-
Expression Region
1-242aa
-
AA Sequence
MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVE RLLFLRENIQRLQGDQGEHSASQIFQSDWLSKRQHPGKREEEEEEGVEEE EEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPK RQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQ GAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TRH (Thyrotropin-Releasing Hormone) is a tripeptide that plays a crucial role in the regulation of thyroid function and overall endocrine system activity. Research on recombinant TRH proteins has gained prominence due to their potential therapeutic applications in treating various disorders, including hypothyroidism and certain mood disorders. Traditionally, TRH was extracted from animal sources, but with advancements in biotechnology, researchers have focused on producing recombinant TRH through methods such as recombinant DNA technology. This approach not only ensures a more consistent and abundant supply of the hormone but also allows for modifications that could enhance its stability and efficacy. Moreover, understanding the structure-function relationship of TRH through recombinant methods allows scientists to explore its interactions with specific receptors, paving the way for novel drug development. The growing interest in TRH also stems from its role in the central nervous system, where it influences aspects of behavior and stress response. As research continues, the production of recombinant TRH promises to unlock new insights into its physiological roles and therapeutic potential, potentially addressing unmet medical needs in various fields, including endocrinology and psychiatry.
