Analytical Data
-
Gene name
TMEM17
- Application
-
Alternative Names
TMEM17; Transmembrane Protein 17
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86X19
-
Expression Region
1-198 aa
-
AA Sequence
MELPDPVRQRLGNFSRAVFSDSNRTSPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYSILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLEKAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI
-
Molecular Weight
49.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM17, a transmembrane protein, has garnered significant attention in recent years due to its potential roles in various biological processes and diseases. Initially identified as a protein with unknown function, subsequent studies have linked TMEM17 to crucial cellular functions, including ion transport, cell signaling, and membrane dynamics. Its expression is found in multiple tissues, suggesting a widespread influence, particularly in the nervous system and immune cells. Research indicates that TMEM17 may be implicated in the regulation of autophagy and apoptosis, processes essential for maintaining cellular homeostasis. Given its involvement in these critical functions, alterations in TMEM17 expression or function have been associated with various pathologies, including cancer and neurodegenerative disorders. As a result, the characterization of recombinant TMEM17 protein has become imperative for understanding its structure-function relationship and exploring its potential as a therapeutic target. The production of TMEM17 in recombinant systems enables detailed biochemical analyses, facilitating studies on its interactions and mechanisms of action. This research not only aims to elucidate the biological significance of TMEM17 but also to provide insights into its role in disease mechanisms, potentially leading to novel diagnostic and therapeutic strategies. Ultimately, understanding TMEM17's function could unlock new avenues in the treatment of diseases where its dysregulation plays a critical role.
