Cat: PAX2000-12023

Recombinant Human TMEM17 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMEM17

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMEM17; Transmembrane Protein 17

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86X19

  • Expression Region

    1-198 aa

  • AA Sequence

    MELPDPVRQRLGNFSRAVFSDSNRTSPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYSILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLEKAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI

  • Molecular Weight

    49.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMEM17, a transmembrane protein, has garnered significant attention in recent years due to its potential roles in various biological processes and diseases. Initially identified as a protein with unknown function, subsequent studies have linked TMEM17 to crucial cellular functions, including ion transport, cell signaling, and membrane dynamics. Its expression is found in multiple tissues, suggesting a widespread influence, particularly in the nervous system and immune cells. Research indicates that TMEM17 may be implicated in the regulation of autophagy and apoptosis, processes essential for maintaining cellular homeostasis. Given its involvement in these critical functions, alterations in TMEM17 expression or function have been associated with various pathologies, including cancer and neurodegenerative disorders. As a result, the characterization of recombinant TMEM17 protein has become imperative for understanding its structure-function relationship and exploring its potential as a therapeutic target. The production of TMEM17 in recombinant systems enables detailed biochemical analyses, facilitating studies on its interactions and mechanisms of action. This research not only aims to elucidate the biological significance of TMEM17 but also to provide insights into its role in disease mechanisms, potentially leading to novel diagnostic and therapeutic strategies. Ultimately, understanding TMEM17's function could unlock new avenues in the treatment of diseases where its dysregulation plays a critical role.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US