Analytical Data
-
Gene name
FAM100B
- Application
-
Alternative Names
UBALD2; FAM100B; UBA-like domain-containing protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IYN6
-
Expression Region
1-164aa
-
AA Sequence
MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR
-
Molecular Weight
44.44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM100B, a member of the FAM100 protein family, has garnered increasing interest in recent years due to its potential roles in various biological processes and diseases. This protein is involved in cell proliferation, differentiation, and apoptosis, suggesting its significance in both normal physiological functions and pathological conditions, including cancer. The reorganization and expression of FAM100B have been linked to the regulation of other critical signaling pathways, such as those involved in the DNA damage response and immune system modulation. Given its implications in tumorigenesis and other disorders, researchers are focused on elucidating the structure-function relationship of FAM100B, particularly through recombinant protein studies. These investigations aim to clarify the molecular mechanisms by which FAM100B exerts its effects, which could lead to novel therapeutic strategies targeting this protein in oncology and other fields. Furthermore, studying FAM100B in the context of different tissues and cell types may reveal its diverse functional roles, enhancing our understanding of its contribution to health and disease. Thus, FAM100B represents a promising avenue for future research in molecular biology and medicine.
