Analytical Data
-
Gene name
ZNF593
- Application
-
Alternative Names
Zinc finger Protein 593; Zinc finger Protein LOC51042; Zinc finger Protein T86; ZN593_HUMAN; znf593; ZT86
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00488
-
Expression Region
1-116 aa
-
AA Sequence
MKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSANLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST
-
Molecular Weight
38.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF593 is a member of the zinc-finger protein family, which plays crucial roles in gene regulation, cell differentiation, and development. Research into ZNF593 has gained momentum due to its potential implications in various biological processes and diseases, particularly in cancers and genetic disorders. The protein is characterized by its conserved zinc-finger motifs, which allow it to bind to specific DNA sequences and regulate target gene expression. Studies have suggested that ZNF593 may contribute to transcriptional repression and may interact with other regulatory proteins, highlighting its role in complex genetic networks. Additionally, abnormalities in ZNF593 expression or function could be linked to pathological conditions, making it a candidate for functional studies that explore its role in disease mechanisms. The recombinant production of ZNF593 facilitates detailed investigations into its structure, function, and potential as a therapeutic target. Understanding ZNF593's biological functions and interactions is crucial for elucidating its role in health and disease, paving the way for novel strategies in gene therapy and targeted molecular treatments. As research continues to uncover the multifaceted roles of ZNF593, it holds promise as a significant biomarker and therapeutic target in the field of molecular biology and medicine.
