Cat: PA1000-8494

Recombinant Human BMP15 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BMP15

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BMP15;GDF9B;Bone morphogenetic Protein 15

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95972

  • Expression Region

    268-392aa

  • AA Sequence

    QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

  • Molecular Weight

    14.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BMP15 (Bone Morphogenetic Protein 15) is a member of the transforming growth factor-beta (TGF-β) superfamily, primarily expressed in ovarian follicles and playing a crucial role in ovarian function and fertility. Research on BMP15 has gained significance due to its involvement in various reproductive processes, including oocyte maturation, folliculogenesis, and regulation of steroidogenesis. Mutations or dysregulation of BMP15 have been linked to conditions such as premature ovarian insufficiency and infertility in females. The recombinant protein form of BMP15 has been developed for studies aimed at elucidating its biological functions and mechanisms of action in ovarian physiology. By producing BMP15 as a recombinant protein, researchers can investigate its effects on follicular development and oocyte quality in controlled laboratory settings. Additionally, recombinant BMP15 provides a valuable tool for exploring therapeutic applications, potentially addressing fertility issues in humans and livestock. The ability to manipulate BMP15 signaling pathways may lead to novel strategies for enhancing reproductive health and developing targeted treatments for ovarian dysfunction. Overall, the study of recombinant BMP15 is pivotal in advancing our understanding of reproductive biology and may contribute to innovative solutions for infertility.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US