Cat: PA1000-8789

Recombinant Human TRAM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TRAM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TRAM1;TRAM;Translocating chain-associated membrane Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15629

  • Expression Region

    1-374aa

  • AA Sequence

    MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIF VTLQYNVTLPATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEY MLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPT ILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYI GLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNEKYQKGF SLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAV LASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGT ENGVNGTLTSNVADSPRNKKEKSS

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TRAM1 (Translocating Chain-Associated Membrane Protein 1) is a crucial protein involved in the translocation process of polypeptides across the endoplasmic reticulum (ER) membrane, playing a vital role in protein synthesis and maturation. Research on TRAM1 has gained significance due to its implications in various biological processes and diseases, including cancer and neurodegenerative disorders. Studies have shown that TRAM1 functions in the recognition and integration of nascent polypeptides into the ER membrane, which is essential for proper protein folding and eventual trafficking to their functional destinations. The understanding of TRAM1's structure and function is critical for deciphering the mechanisms underlying protein translocation and for developing therapeutic strategies targeting related pathologies. Recent advances in recombinant protein technology have facilitated the study of TRAM1, allowing researchers to produce and characterize this protein in vitro. Investigating TRAM1 through recombinant methods not only enhances our comprehension of its biological roles but also provides insights into its potential as a drug target. Overall, TRAM1 stands at the intersection of molecular biology and therapeutic development, making it a focal point for ongoing research in the field of cellular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US