Analytical Data
-
Gene name
FOXR2
- Application
-
Alternative Names
Forkhead box protein N6; Forkhead box protein R2; FOXN6; Foxr2; FOXR2_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PJQ5
-
Expression Region
1-311aa
-
AA Sequence
MDLKLKDCEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWMWVDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHSPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNCSHLIALALRNNPHCGLSVQEIYNFTRQHFPFFWTAPDGWKSTIHYNLCFLDSFEKVPDSLKDEDNARPRSCLWKLTKEGHRRFWEETRVLAFAQRERIQECMSQPELLTSLFDL
-
Molecular Weight
59.95 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FOXR2 (Forkhead Box R2) is a member of the forkhead family of transcription factors, which play crucial roles in various biological processes, including development, cell differentiation, and apoptosis. Recent studies have implicated FOXR2 in several key physiological functions, as well as potential associations with various diseases, such as developmental disorders and cancers. The expression of FOXR2 is particularly prominent in the brain, suggesting it may have essential roles in neurodevelopment and cognitive functions. Given its involvement in essential cellular processes and potential links to pathological conditions, there is a growing interest in the study of FOXR2 recombinant proteins. These proteins allow researchers to explore its functional mechanisms, signaling pathways, and interactions with other cellular molecules in a controlled environment. Understanding FOXR2's specific roles could provide valuable insights into its contribution to normal biological processes and its implications in disease, paving the way for potential therapeutic interventions. The development of FOXR2 recombinant proteins thus represents a significant advancement in the exploration of the functional dynamics of this transcription factor in both health and disease contexts.











