Analytical Data
-
Gene name
FUSIP1
- Application
-
Alternative Names
FUS interacting protein serine arginine rich 2; FUS interacting serine arginine rich protein 1; FUS-interacting serine-arginine-rich protein 1; FUSIP1; FUSIP2; NSSR; OTTHUMP00000015774; Serine arginine repressor protein 40 kDa; Serine/arginine-rich splicing factor 10; SFRS13; SFRS13A; Splicing factor; Splicing factor arginine serine rich 13; Splicing factor SRp38; SRp38; SRp40; SRrp40; SRS10_HUMAN; Srsf10; TASR; TASR1; TASR2; TLS associated protein TASR1; TLS associated protein TASR2; TLS associated protein with Ser Arg repeats; TLS associated protein with SR repeats; TLS associated serine arginine protein 1; TLS associated serine arginine protein 2; TLS associated serine arginine protein; TLS associated SR protein; TLS-associated protein with Ser-Arg repeats
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75494
-
Expression Region
1-183aa
-
AA Sequence
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI
-
Molecular Weight
38.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FUSIP1 (Fused in Sarcoma Interacting Protein 1) is a protein that has garnered attention due to its potential roles in cellular processes and disease mechanisms. As a member of the FUS family, it is involved in various cellular functions, including RNA processing, stress responses, and cell signaling. Its significance is particularly highlighted in the context of neurodegenerative diseases, where abnormalities in RNA metabolism and protein aggregation are common features. The study of FUSIP1 is crucial for understanding its interactions with other proteins, including disease-related factors, and its influence on cellular homeostasis. Additionally, research on the recombinant expression of FUSIP1 allows for the investigation of its functional properties and the elucidation of pathways it may regulate. The development of FUSIP1 as a recombinant protein has the potential to enhance our understanding of its biological functions and its implications in pathology, offering insights that could lead to therapeutic innovations in treating diseases linked to FUS family proteins. As such, FUSIP1 represents a valuable target for further exploration in the fields of molecular biology and medicine.
