Analytical Data
-
Gene name
FXC1
- Application
-
Alternative Names
Fracture callus 1 homolog (rat); Fracture callus 1 homolog; Fracture callus protein 1; FxC1; Mitochondrial import inner membrane translocase subunit Tim10 B; Mitochondrial import inner membrane translocase subunit Tim9 B; OTTHUMP00000164584; OTTHUMP00000230720; TIM 10B; Tim10b; Tim9b; TIM9B_HUMAN; TIMM10B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5J6
-
Expression Region
1-103aa
-
AA Sequence
MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASTVPSVAAEQPGVSPSGS
-
Molecular Weight
37.07 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FXR2, or Fragile X Mental Retardation 2, is a protein that plays a crucial role in the regulation of gene expression and is associated with the Fragile X syndrome, a leading cause of inherited intellectual disability. Unlike its well-studied counterpart FXR1, FXR2 is less understood, yet it is implicated in various cellular processes, including RNA metabolism, translation, and synaptic plasticity. Research on FXR2 has gained momentum due to its potential roles in neurodevelopmental disorders and its contribution to the pathogenesis of Fragile X syndrome. Recent studies have focused on elucidating its molecular mechanisms and interactions with RNA and other proteins, which could provide insights into its function in neuronal development and cognitive processes. Understanding FXR2's role may lead to novel therapeutic strategies for conditions related to cognitive impairment and may shed light on the intricate pathways involved in neurodevelopment. As the field progresses, the exploration of FXR2's functions and interactions continues to uncover its significance in health and disease, making it a promising target for future research in molecular neuroscience and genetic therapies.











