Analytical Data
-
Gene name
FYTTD1
- Application
-
Alternative Names
DKFZp761B1514; Forty two three domain containing 1; Forty two three domain containing protein 1; Forty-two-three domain-containing protein 1; FYTTD 1; fyttd1; OTTHUMP00000208028; OTTHUMP00000208031; OTTHUMP00000208032; Protein 40 2 3; Protein 40-2-3; UAP56 interacting factor; UAP56-interacting factor; UIF; UIF_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96QD9
-
Expression Region
1-318aa
-
AA Sequence
MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLLQQSGAQQFRMRVRWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDKNIEQYFPVLKRKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDINSVGKQTGMTLNERFGILKEQRATLTYNKGGSRFVTVG
-
Molecular Weight
62.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FYTTD1 is a recently identified protein that has drawn significant attention in the field of molecular biology due to its potential roles in cellular processes. Research has indicated that FYTTD1 may be involved in regulating various biological pathways, including cell proliferation, differentiation, and stress responses. This protein contains specific structural motifs suggesting it might interact with other cellular proteins, influencing signaling cascades and gene expression. Its expression patterns in different tissues and during various developmental stages underscore its importance in physiological and possibly pathological contexts. Recent studies have focused on characterizing the biophysical properties of FYTTD1 and elucidating its functional mechanisms, with the goal of understanding its contributions to cellular homeostasis and disease states, particularly cancer and other metabolic disorders. Investigating FYTTD1 could lead to novel therapeutic strategies, as targeting its pathways might offer new avenues for treatment, making it a promising subject for ongoing research in biochemistry and medical sciences.
