Cat: IPD-X50023

Recombinant Pig M130 (CD163)protein, His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD163

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD163;M130

  • Species

    Pig

  • Source

    E. coli

  • Tag

    C-terminal 10xHis-tagged

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q2VL90

  • Expression Region

    50-475aa

  • AA Sequence

    ELRLTGGENKCSGRVEVKVQEEWGTVCNNGWDMDVVSVVCRQLGCPTAIKATGWANFSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHNCTHQQDAGVTCSDGSDLEMGLVNGGNRCLGRIEVKFQGRWGTVCDDNFNINHASVVCKQLECGSAVSFSGSANFGEGSGPIWFDDLVCNGNESALWNCKHEGWGKHNCDHAEDAGVICLNGADLKLRVVDGVTECSGRLEVKFQGEWGTICDDGWDSDDAAVACKQLGCPTAVTAIGRVNASEGTGHIWLDSVSCHGHESALWQCRHHEWGKHYCNHDEDAGVTCSDGSDLELRLKGGGSHCAGTVEVEIQKLVGKVCDRSWGLKEADVVCRQLGCGSALKTSYQVYSKTKATNTWLFVSSCNGNETSLWDCKNWQWGGLSCDHYDEAKITCSAHR

  • Molecular Weight

    52.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD163 is a type I transmembrane glycoprotein predominantly expressed on the surface of monocytes and macrophages. It serves as a receptor for hemoglobin-haptoglobin complexes and plays a crucial role in anti-inflammatory responses and immune regulation. Research on CD163 has gained significant interest due to its involvement in various physiological and pathological processes, including tissue repair, the regulation of inflammatory responses, and the modulation of autoimmune diseases. Alterations in CD163 expression have been linked to several conditions, such as cardiovascular diseases, chronic inflammatory diseases, and certain cancers. The soluble form of CD163 (sCD163) released from macrophages into circulation has emerged as a potential biomarker for disease progression and severity. As a result, recombinant CD163 protein is crucial for further studies aiming to elucidate its functional mechanisms, potential therapeutic applications, and its role in disease pathogenesis. Studies using recombinant CD163 can provide insights into its interactions with various ligands and its impact on macrophage polarization, which in turn could lead to novel therapeutic strategies targeting inflammatory diseases and enhancing immune responses in cancer therapy. Understanding the detailed biology of CD163 through recombinant protein studies holds promise for developing innovative approaches in both diagnostics and therapeutics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US