Analytical Data
-
Gene name
CD163
- Application
-
Alternative Names
CD163;M130
-
Species
Pig
-
Source
E. coli
-
Tag
C-terminal 10xHis-tagged
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q2VL90
-
Expression Region
50-475aa
-
AA Sequence
ELRLTGGENKCSGRVEVKVQEEWGTVCNNGWDMDVVSVVCRQLGCPTAIKATGWANFSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHNCTHQQDAGVTCSDGSDLEMGLVNGGNRCLGRIEVKFQGRWGTVCDDNFNINHASVVCKQLECGSAVSFSGSANFGEGSGPIWFDDLVCNGNESALWNCKHEGWGKHNCDHAEDAGVICLNGADLKLRVVDGVTECSGRLEVKFQGEWGTICDDGWDSDDAAVACKQLGCPTAVTAIGRVNASEGTGHIWLDSVSCHGHESALWQCRHHEWGKHYCNHDEDAGVTCSDGSDLELRLKGGGSHCAGTVEVEIQKLVGKVCDRSWGLKEADVVCRQLGCGSALKTSYQVYSKTKATNTWLFVSSCNGNETSLWDCKNWQWGGLSCDHYDEAKITCSAHR
-
Molecular Weight
52.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
CD163 is a type I transmembrane glycoprotein predominantly expressed on the surface of monocytes and macrophages. It serves as a receptor for hemoglobin-haptoglobin complexes and plays a crucial role in anti-inflammatory responses and immune regulation. Research on CD163 has gained significant interest due to its involvement in various physiological and pathological processes, including tissue repair, the regulation of inflammatory responses, and the modulation of autoimmune diseases. Alterations in CD163 expression have been linked to several conditions, such as cardiovascular diseases, chronic inflammatory diseases, and certain cancers. The soluble form of CD163 (sCD163) released from macrophages into circulation has emerged as a potential biomarker for disease progression and severity. As a result, recombinant CD163 protein is crucial for further studies aiming to elucidate its functional mechanisms, potential therapeutic applications, and its role in disease pathogenesis. Studies using recombinant CD163 can provide insights into its interactions with various ligands and its impact on macrophage polarization, which in turn could lead to novel therapeutic strategies targeting inflammatory diseases and enhancing immune responses in cancer therapy. Understanding the detailed biology of CD163 through recombinant protein studies holds promise for developing innovative approaches in both diagnostics and therapeutics.











