Cat: IPD-X50115

Recombinant Human CCNB1 Protein,His&GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCNB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCNB1;CCNB;G2/mitotic-specific cyclin-B1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6His+GST

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P14635

  • Expression Region

    1-433aa

  • AA Sequence

    MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEP VPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLG REVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILR ALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVV MVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

  • Molecular Weight

    77.1kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCNB1, or cyclin B1, is a critical regulatory protein involved in the control of the cell cycle, particularly during the transition from the G2 phase to mitosis. It forms complexes with cyclin-dependent kinases (CDKs), primarily CDK1, to promote the initiation of mitosis. Understanding the function and regulation of CCNB1 is crucial, as dysregulation of this protein can lead to various diseases, including cancer. Abnormal expression levels of CCNB1 have been associated with tumorigenesis, where its overexpression often correlates with poor prognosis in several cancer types. Research on recombinant CCNB1 proteins has gained momentum as it allows for detailed studies of its structure, function, and interactions with other cellular components. By producing CCNB1 in recombinant systems, researchers can investigate its role in cell cycle regulation, explore the mechanisms of CDK activation, and develop potential therapeutic strategies aimed at targeting cyclin B1/CDK complexes. Additionally, these studies can facilitate the identification of small molecules or antibodies that can disrupt aberrant CCNB1 activity in cancer cells, offering new avenues for cancer treatment. Overall, the recombinant expression of CCNB1 serves as a powerful tool for elucidating the complexities of cell cycle regulation and its implications in human diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US