Cat: IPD-X50201

Recombinant Human CTSS Protein,6xHis

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CTSS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cathepsin S; CathepsinS; CATS_HUMAN; Ctss

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal 6xHis-tagged

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P25774

  • Expression Region

    115-331aa

  • AA Sequence

    LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI

  • Molecular Weight

    28.0kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CTSS (cathepsin S) is a cysteine protease that plays a crucial role in various physiological and pathological processes, including immune response, inflammation, and cancer progression. It is primarily expressed in antigen-presenting cells, where it contributes to the processing of protein antigens for presentation on major histocompatibility complex (MHC) molecules. This function is vital for the activation of CD4+ T cells and thereby influences adaptive immunity. Dysregulation of CTSS has been implicated in a range of diseases, notably autoimmune disorders and tumors, making it a target for therapeutic intervention. Moreover, CTSS has been studied for its potential utility as a biomarker for certain diseases due to its differential expression patterns in various conditions. Recent advancements in recombinant protein technology have facilitated the production of CTSS in a controlled laboratory setting, enabling detailed studies of its structure-function relationship and enzymatic mechanisms. Understanding the biological roles of CTSS and developing recombinant forms have significant implications for drug design, vaccine development, and therapeutic strategies aimed at modulating immune responses. Research on CTSS thus presents a promising avenue for enhancing our comprehension of immune regulation and cancer biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US