Analytical Data
-
Gene name
ANGPTL7/Angiopoietin-related 7
-
简介
ANGPTL7/angiopoietin-related 7 protein plays a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it serves as a mediator for dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue that studies have shown is necessary for aqueous humor outflow and maintenance of intraocular pressure. ANGPTL7/Angiopoietin-related 7 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ANGPTL7/Angiopoietin-related 7 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
When Recombinant Human LILRB2 Protein is immobilized at 5 µg/mL (100 µL/well) can bind Biotinylated Rhesus Macaque ANGPTL7 Protein. The ED50 for this effect is 0.472 μg/mL. When Recombinant Human LILRB2 Protein is immobilized at 5 µg/mL (100µL/well) can bind Biotinylated Rhesus Macaque ANGPTL7 Protein. The ED50 for this effect is 0.472 μg/mL.
-
Alternative Names
Angiopoietin like 7; ANGPTL7; CDT6
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
F7HQR6
-
Expression Region
Q27-P344
-
AA Sequence
QKPSKRKTPAQLKAATCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
31-35 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANGPTL7 (Angiopoietin-like 7) is a member of the angiopoietin-like protein family, which plays a critical role in various physiological processes, including angiogenesis, inflammation, and metabolism. It is primarily expressed in the tissues of the eye, heart, and adipose tissue, implicating its potential significance in cardiovascular diseases and metabolic disorders. Recent studies have suggested that ANGPTL7 may influence lipid metabolism by modulating lipoprotein lipase activity, thereby impacting systemic lipid levels. Furthermore, its involvement in the regulation of inflammatory responses positions ANGPTL7 as a potential therapeutic target for conditions characterized by chronic inflammation and vascular dysfunction. The recombinant protein form of ANGPTL7 is being investigated to elucidate its biological functions and therapeutic potentials, particularly in the context of cardiovascular health and metabolic regulation. Understanding the mechanisms by which ANGPTL7 operates could pave the way for novel interventions in diseases where lipid metabolism and angiogenesis are disrupted, highlighting the need for ongoing research into its structure, function, and application in clinical settings.











