Analytical Data
-
Gene name
Streptokinase G
-
简介
Streptokinase G protein, devoid of protease activity, complexes with plasminogen, inducing its activation. Serving as a potential virulence factor, Streptokinase G is implicated in hindering robust fibrin barriers at infection sites, potentially augmenting microbial pathogenicity. Its activation of plasminogen highlights its role in manipulating the host's fibrinolytic system—a strategy employed to evade defenses and enhance infection. Streptokinase G Protein, Streptococcus sp. (His) is the recombinant Streptokinase G protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
skg; Streptokinase G
-
Species
Others
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P10519
-
Expression Region
I27-K440
-
AA Sequence
IAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKLFATDSGAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPIQPVQEFLLKGHVRVRPYKEKPVQNQAKSVDVEYTVQFTPLNPDDDFRPALKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
Predict MW: 48.16 kDa; 50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Streptokinase G is a recombinant protein derived from the bacterium Streptococcus pyogenes, which plays a critical role in thrombolytic therapy. It functions as a plasminogen activator, converting plasminogen into plasmin, thereby facilitating the breakdown of blood clots. The background research into Streptokinase G stems from the need for effective treatments for conditions such as myocardial infarction and pulmonary embolism, where the rapid dissolution of clots can significantly enhance patient outcomes. Traditional thrombolytic agents, while effective, often carry the risk of adverse effects and allergic reactions. The recombinant version of streptokinase aims to overcome these issues by providing a more targeted approach. Advances in molecular biology techniques have allowed for the production of high-yield recombinant streptokinase in various expression systems, enhancing its stability and bioavailability. Furthermore, studies investigating its efficacy and safety profile compared to other thrombolytics have gained attention. The research focuses not only on optimizing the production and purification of Streptokinase G but also on understanding its mechanism of action at the molecular level, potential immunogenicity, and ways to minimize side effects. This ongoing research has the potential to lead to the development of more efficient therapeutic options that could improve the management of thrombotic diseases, ultimately benefiting a wide range of patients at risk for cardiovascular events.
