Analytical Data
-
Gene name
CRADD
-
简介
As an adapter protein, CRADD forms a PIDDosome complex with PIDD1 and CASP2, activates CASP2 and initiates apoptosis. It also recruits CASP2 to the TNFR-1 signaling complex in the tumor necrosis factor-mediated pathway, interacting with RIPK1 and TRADD. CRADD Protein, Human is the recombinant human-derived CRADD protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
rHuDeath domain-containing protein CRADD/CRADD; Death Domain-Containing Protein CRADD; Caspase and RIP Adapter with Death Domain; RIP-Associated Protein with A Death Domain; CRADD; RAIDD
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78560
-
Expression Region
M1-E199
-
AA Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
-
Protein Length
Full Length
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRADD (Caspase-8-Activating Adaptor Protein) is a key player in the apoptotic signaling pathways, particularly in mediating the interaction between death receptors and caspases, which are crucial for inducing programmed cell death. Its role has been linked to various cellular processes such as cell differentiation, proliferation, and survival, making it a focal point of interest in cancer research and therapeutic developments. The study of CRADD's structure and its functional domains has garnered attention for potential implications in understanding how dysregulation of apoptosis contributes to tumorigenesis and resistance to chemotherapy. Additionally, the ability of CRADD to interact with other apoptotic proteins suggests that it may serve as a strategic target for novel cancer treatments that aim to restore the apoptotic pathways impaired in cancer cells. By utilizing recombinant DNA technology, researchers are exploring the production of CRADD fusion proteins to investigate their biological activity, interactions, and potential therapeutic applications. Ultimately, these studies aim to develop strategies that harness CRADD's apoptotic capabilities to enhance cancer treatments and improve patient outcomes. Through in-depth characterization of CRADD and its role in apoptotic signaling, researchers strive to provide valuable insights that could lead to innovative approaches in combating various forms of cancer.
