Analytical Data
-
Gene name
GPR56
-
简介
GPR56, a cell adhesion receptor, mediates cell-matrix adhesion in developing neurons and hematopoietic stem cells. It acts as a receptor for collagen III (COL3A1), influencing cortical development and hematopoietic stem cell maintenance. Additionally, GPR56 plays a pivotal role in cancer progression by inhibiting angiogenesis via PRKCA-mediated signaling and is essential for testis development. GPR56 Protein, Human (HEK293, His) is the recombinant human-derived GPR56 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Adhesion G-protein coupled receptor G1; ADGRG1 NT; ADGRG1; GPR56; TM7LN4; TM7XN1
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y653-2
-
Expression Region
R26-V342
-
AA Sequence
RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNV
-
Protein Length
Partial
-
Molecular Weight
45-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR56, a member of the G protein-coupled receptor (GPCR) family, has garnered significant interest in recent years due to its role in various physiological processes and its implications in several diseases. Originally identified as a receptor involved in the regulation of cell adhesion and migration, GPR56 plays a crucial role in brain development, particularly in the formation and organization of the cerebral cortex. Mutations in the GPR56 gene have been linked to developmental disorders, particularly in a rare neurodevelopmental condition known as bilateral frontoparietal polymicrogyria, highlighting its importance in neurogenesis. Furthermore, GPR56 has been implicated in cancer biology, where its expression levels can influence tumor progression and metastasis in several cancer types. As a result, the exploration of GPR56 recombinant proteins has become a focal point for researchers aiming to elucidate its functional mechanisms and potential therapeutic applications. The generation of recombinant GPR56 allows for detailed structural and functional studies, enabling the assessment of its ligand interactions and signaling pathways. This research not only enhances our understanding of GPR56's biological roles but also opens avenues for the development of targeted therapies that could modulate its activity in pathological conditions, making it a promising candidate for drug discovery and development in the fields of neurology and oncology.











