Cat: PA1000-55DB

Recombinant Human ACYP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACYP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACYP1;ACYPE;Acylphosphatase-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07311

  • Expression Region

    1- 99aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAEGNTLISVDYEIFGKVQGVFFRKHT QAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHID KANFNNEKVILKLDYSDFQIVK

  • Molecular Weight

    14 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACYP1, or Acylphosphatase 1, is an important enzyme implicated in various biological processes, including muscle function, metabolism, and signal transduction. Its primary role involves the hydrolysis of acyl phosphate bonds, thus influencing energy homeostasis in cells. Recent studies have indicated that ACYP1 may play a critical role in the regulation of cellular stress responses, including those induced by oxidative stress, as well as in certain pathological conditions such as cancer and heart disease. Given its significance, the recombinant expression of ACYP1 has garnered increasing attention in biochemical research, aiming to elucidate its structural and functional properties in detail. Producing ACYP1 as a recombinant protein allows researchers to investigate its enzymatic activity, interaction with other proteins, and its potential as a therapeutic target. This research is vital for understanding the mechanistic pathways involving ACYP1 and exploring its application in drug development and disease management. Through advanced techniques such as site-directed mutagenesis and structural analysis using X-ray crystallography or NMR spectroscopy, scientists are working to determine the precise mechanisms by which ACYP1 exerts its effects at the molecular level. Understanding these dynamics not only enhances the fundamental knowledge of enzymatic functions but also paves the way for innovative therapeutic strategies targeting ACYP1-related pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US