Analytical Data
-
Gene name
SOCS1
- Application
-
Alternative Names
SOCS1；SSI1；TIP3；；Suppressor of cytokine signaling 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15524
-
Expression Region
1-211aa
-
AA Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAP GDTHFRTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGT FLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFEL LEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVL RDYLSSFPFQI
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Suppressor of Cytokine Signaling 1 (SOCS1) is a key protein in the regulation of cytokine signaling pathways, particularly those involving interleukin-6 (IL-6) and interferon-gamma (IFN-γ). As a member of the SOCS family, SOCS1 plays a crucial role in maintaining immune homeostasis by inhibiting the JAK/STAT signaling cascade, which is vital for cell proliferation, differentiation, and survival. Dysregulation of SOCS1 expression has been implicated in various pathological conditions, including autoimmune diseases, chronic inflammation, and cancer. Research into recombinant SOCS1 has gained traction due to its potential therapeutic applications, as understanding its structure and function may lead to novel strategies to modulate immune responses. Studies have shown that restoring SOCS1 activity could suppress aberrant signaling in tumor microenvironments, providing insights into cancer therapies. Moreover, SOCS1's ability to fine-tune immune responses offers promising avenues for treating inflammatory diseases. Investigating the recombinant production and functional assays of SOCS1 can help elucidate the molecular mechanisms behind its action and pave the way for innovative biological drugs. The ongoing exploration of SOCS1 not only enhances our understanding of cytokine signaling but also positions it as a critical target in the development of targeted therapies for various immune-related disorders.
