Cat: PA1000-9045

Recombinant Human SOCS1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SOCS1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SOCS1;SSI1;TIP3;;Suppressor of cytokine signaling 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15524

  • Expression Region

    1-211aa

  • AA Sequence

    MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAP GDTHFRTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGT FLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFEL LEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVL RDYLSSFPFQI

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Suppressor of Cytokine Signaling 1 (SOCS1) is a key protein in the regulation of cytokine signaling pathways, particularly those involving interleukin-6 (IL-6) and interferon-gamma (IFN-γ). As a member of the SOCS family, SOCS1 plays a crucial role in maintaining immune homeostasis by inhibiting the JAK/STAT signaling cascade, which is vital for cell proliferation, differentiation, and survival. Dysregulation of SOCS1 expression has been implicated in various pathological conditions, including autoimmune diseases, chronic inflammation, and cancer. Research into recombinant SOCS1 has gained traction due to its potential therapeutic applications, as understanding its structure and function may lead to novel strategies to modulate immune responses. Studies have shown that restoring SOCS1 activity could suppress aberrant signaling in tumor microenvironments, providing insights into cancer therapies. Moreover, SOCS1's ability to fine-tune immune responses offers promising avenues for treating inflammatory diseases. Investigating the recombinant production and functional assays of SOCS1 can help elucidate the molecular mechanisms behind its action and pave the way for innovative biological drugs. The ongoing exploration of SOCS1 not only enhances our understanding of cytokine signaling but also positions it as a critical target in the development of targeted therapies for various immune-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US